R version: R version 3.5.0 (2018-04-23)
Bioconductor version: 3.7
Package version: 1.2.0
Table of Contents
Introduction
Version Info
Top
The follow packages will be used throughout this documents. R version
3.3.1 or higher is required to install all the packages using
BiocInstaller::biocLite.
library("mzR")
library("mzID")
library("MSnID")
library("MSnbase")
library("rpx")
library("MLInterfaces")
library("pRoloc")
library("pRolocdata")
library("MSGFplus")
library("rols")
library("hpar")
The most convenient way to install all the tutorials requirement (and more related content), is to install RforProteomics with all its dependencies.
library("BiocInstaller")
biocLite("RforProteomics", dependencies = TRUE)
Other packages of interest, such as rTANDEM or MSGFgui will be described later in the document but are not required to execute the code in this workflow.
Table of Contents
Exploring available infrastructure
Setup
Top
This workflow illustrates R / Bioconductor infrastructure for proteomics. Topics covered focus on support for open community-driven formats for raw data and identification results, packages for peptide-spectrum matching, data processing and analysis:
Links to other packages and references are also documented. In particular, the vignettes included in the RforProteomics package also contains relevant material.
Table of Contents
Mass spectrometry data
Introduction
Top
In Bioconductor version 3.7, there are respectively 105
proteomics,
70
mass spectrometry software packages
and 19
mass spectrometry experiment packages. These
respective packages can be extracted with the proteomicsPackages(),
massSpectrometryPackages() and massSpectrometryDataPackages() and
explored interactively.
library("RforProteomics")
pp <- proteomicsPackages()
display(pp)
Table of Contents
Getting data from proteomics repositories
Exploring available infrastructure
Top
Most community-driven formats are supported in R, as detailed in the
table below.
| Type | Format | Package |
|---|---|---|
| raw | mzML, mzXML, netCDF, mzData | mzR (read) |
| identification | mzIdentML | mzR (read) and mzID (read) |
| quantitation | mzQuantML | |
| peak lists | mgf | MSnbase (read/write) |
| other | mzTab | MSnbase (read) |
Table of Contents
Handling raw MS data
Mass spectrometry data
Top
MS-based proteomics data is disseminated through the ProteomeXchange infrastructure, which centrally coordinates submission, storage and dissemination through multiple data repositories, such as the PRIDE data base at the EBI for MS/MS experiments, PASSEL at the ISB for SRM data and the MassIVE resource. The rpx is an interface to ProteomeXchange and provides a basic access to PX data.
library("rpx")
pxannounced()
## 15 new ProteomeXchange annoucements
## Data.Set Publication.Data Message
## 1 PXD006053 2018-05-18 11:09:51 New
## 2 PXD007744 2018-05-18 11:06:06 New
## 3 PXD009730 2018-05-18 10:42:52 New
## 4 PXD005603 2018-05-18 09:40:29 New
## 5 PXD009718 2018-05-18 07:20:05 New
## 6 PXD009717 2018-05-18 07:11:14 New
## 7 PXD009647 2018-05-18 07:03:22 New
## 8 PXD007623 2018-05-17 16:01:10 New
## 9 PXD008538 2018-05-17 15:38:59 New
## 10 PXD006916 2018-05-17 15:12:17 New
## 11 PXD009014 2018-05-17 14:56:45 New
## 12 PXD006250 2018-05-17 14:47:46 Updated information
## 13 PXD009210 2018-05-17 14:46:18 New
## 14 PXD007679 2018-05-17 14:44:50 New
## 15 PXD007977 2018-05-17 13:50:44 New
Using the unique PXD000001 identifier, we can retrieve the relevant
metadata that will be stored in a PXDataset object. The names of the
files available in this data can be retrieved with the pxfiles
accessor function.
px <- PXDataset("PXD000001")
px
## Object of class "PXDataset"
## Id: PXD000001 with 12 files
## [1] 'F063721.dat' ... [12] 'generated'
## Use 'pxfiles(.)' to see all files.
pxfiles(px)
## [1] "F063721.dat"
## [2] "F063721.dat-mztab.txt"
## [3] "PRIDE_Exp_Complete_Ac_22134.xml.gz"
## [4] "PRIDE_Exp_mzData_Ac_22134.xml.gz"
## [5] "PXD000001_mztab.txt"
## [6] "README.txt"
## [7] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML"
## [8] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzXML"
## [9] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.mzXML"
## [10] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.raw"
## [11] "erwinia_carotovora.fasta"
## [12] "generated"
Other metadata for the px data set:
pxtax(px)
## [1] "Erwinia carotovora"
pxurl(px)
## [1] "ftp://ftp.pride.ebi.ac.uk/pride/data/archive/2012/03/PXD000001"
pxref(px)
## [1] "Gatto L, Christoforou A. Using R and Bioconductor for proteomics data analysis. Biochim Biophys Acta. 2014 1844(1 pt a):42-51"
Data files can then be downloaded with the pxget function. Below, we
retrieve the raw data file. The file is downloaded in the working
directory and the name of the file is return by the function and
stored in the mzf variable for later use.
fn <- "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML"
mzf <- pxget(px, fn)
## Downloading 1 file
mzf
## [1] "/home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML"
Table of Contents
Handling identification data
Getting data from proteomics repositories
Top
The mzR package provides an interface to the
proteowizard C/C++ code base
to access various raw data files, such as mzML, mzXML, netCDF,
and mzData. The data is accessed on-disk, i.e it is not loaded
entirely in memory by default but only when explicitly requested. The
three main functions are openMSfile to create a file handle to a raw
data file, header to extract metadata about the spectra contained in
the file and peaks to extract one or multiple spectra of
interest. Other functions such as instrumentInfo, or runInfo can
be used to gather general information about a run.
Below, we access the raw data file downloaded in the previous section and open a file handle that will allow us to extract data and metadata of interest.
library("mzR")
ms <- openMSfile(mzf)
ms
## Mass Spectrometry file handle.
## Filename: TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML
## Number of scans: 7534
The header function returns the metadata of all available peaks:
hd <- header(ms)
dim(hd)
## [1] 7534 25
names(hd)
## [1] "seqNum" "acquisitionNum"
## [3] "msLevel" "polarity"
## [5] "peaksCount" "totIonCurrent"
## [7] "retentionTime" "basePeakMZ"
## [9] "basePeakIntensity" "collisionEnergy"
## [11] "ionisationEnergy" "lowMZ"
## [13] "highMZ" "precursorScanNum"
## [15] "precursorMZ" "precursorCharge"
## [17] "precursorIntensity" "mergedScan"
## [19] "mergedResultScanNum" "mergedResultStartScanNum"
## [21] "mergedResultEndScanNum" "injectionTime"
## [23] "filterString" "spectrumId"
## [25] "centroided"
We can extract metadata and scan data for scan 1000 as follows:
hd[1000, ]
## seqNum acquisitionNum msLevel polarity peaksCount totIonCurrent
## 1000 1000 1000 2 1 274 1048554
## retentionTime basePeakMZ basePeakIntensity collisionEnergy
## 1000 1106.916 136.061 164464 45
## ionisationEnergy lowMZ highMZ precursorScanNum precursorMZ
## 1000 0 104.5467 1370.758 992 683.0817
## precursorCharge precursorIntensity mergedScan mergedResultScanNum
## 1000 2 689443.7 0 0
## mergedResultStartScanNum mergedResultEndScanNum injectionTime
## 1000 0 0 55.21463
## filterString
## 1000 FTMS + p NSI d Full ms2 683.08@hcd45.00 [100.00-1380.00]
## spectrumId centroided
## 1000 controllerType=0 controllerNumber=1 scan=1000 TRUE
head(peaks(ms, 1000))
## [,1] [,2]
## [1,] 104.5467 308.9326
## [2,] 104.5684 308.6961
## [3,] 108.8340 346.7183
## [4,] 109.3928 365.1236
## [5,] 110.0345 616.7905
## [6,] 110.0703 429.1975
plot(peaks(ms, 1000), type = "h")
Below we reproduce the example from the MSmap function from the
MSnbase package to plot a specific slice of the raw data using the
mzR functions we have just described.
## a set of spectra of interest: MS1 spectra eluted
## between 30 and 35 minutes retention time
ms1 <- which(hd$msLevel == 1)
rtsel <- hd$retentionTime[ms1] / 60 > 30 &
hd$retentionTime[ms1] / 60 < 35
## the map
M <- MSmap(ms, ms1[rtsel], 521, 523, .005, hd)
## 1
plot(M, aspect = 1, allTicks = FALSE)
plot3D(M)
## With some MS2 spectra
i <- ms1[which(rtsel)][1]
j <- ms1[which(rtsel)][2]
M2 <- MSmap(ms, i:j, 100, 1000, 1, hd)
## 1
plot3D(M2)
Table of Contents
MS/MS database search
Handling raw MS data
Top
The RforProteomics package distributes a small identification result
file (see
?TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.mzid) that we
load and parse using infrastructure from the mzID
package.
library("mzID")
f <- dir(system.file("extdata", package = "RforProteomics"),
pattern = "mzid", full.names=TRUE)
basename(f)
## [1] "TMT_Erwinia.mzid.gz"
id <- mzID(f)
## reading TMT_Erwinia.mzid.gz... DONE!
id
## An mzID object
##
## Software used: MS-GF+ (version: Beta (v10072))
##
## Rawfile: /home/lgatto/dev/00_github/RforProteomics/sandbox/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.mzXML
##
## Database: /home/lgatto/dev/00_github/RforProteomics/sandbox/erwinia_carotovora.fasta
##
## Number of scans: 5287
## Number of PSM's: 5563
Various data can be extracted from the mzID object, using one the
accessor functions such as database, scans, peptides, … The
object can also be converted into a data.frame using the flatten
function.
The mzR package also provides support fasta parsing mzIdentML files
with the openIDfile function. As for raw data, the underlying C/C++
code comes from the
proteowizard.
library("mzR")
f <- dir(system.file("extdata", package = "RforProteomics"),
pattern = "mzid", full.names=TRUE)
id1 <- openIDfile(f)
fid1 <- mzR::psms(id1)
head(fid1)
## spectrumID chargeState rank passThreshold experimentalMassToCharge
## 1 scan=5782 3 1 TRUE 1080.2325
## 2 scan=6037 3 1 TRUE 1002.2089
## 3 scan=5235 3 1 TRUE 1189.2836
## 4 scan=5397 3 1 TRUE 960.5365
## 5 scan=6075 3 1 TRUE 1264.3409
## 6 scan=5761 2 1 TRUE 1268.6429
## calculatedMassToCharge sequence modNum isDecoy
## 1 1080.2321 PVQIQAGEDSNVIGALGGAVLGGFLGNTIGGGSGR 0 FALSE
## 2 1002.2115 TQVLDGLINANDIEVPVALIDGEIDVLR 0 FALSE
## 3 1189.2800 TKGLNVMQNLLTAHPDVQAVFAQNDEMALGALR 0 FALSE
## 4 960.5365 SQILQQAGTSVLSQANQVPQTVLSLLR 0 FALSE
## 5 1264.3419 PIIGDNPFVVVLPDVVLDESTADQTQENLALLISR 0 FALSE
## 6 1268.6501 WTSQSSLDLGEPLSLITESVFAR 0 FALSE
## post pre start end DatabaseAccess DBseqLength DatabaseSeq
## 1 S R 50 84 ECA1932 155
## 2 R K 288 315 ECA1147 434
## 3 A R 192 224 ECA0013 295
## 4 - R 264 290 ECA1731 290
## 5 F R 119 153 ECA1443 298
## 6 Y K 264 286 ECA1444 468
## DatabaseDescription acquisitionNum
## 1 ECA1932 outer membrane lipoprotein 5782
## 2 ECA1147 trigger factor 6037
## 3 ECA0013 ribose-binding periplasmic protein 5235
## 4 ECA1731 flagellin 5397
## 5 ECA1443 UTP--glucose-1-phosphate uridylyltransferase 6075
## 6 ECA1444 6-phosphogluconate dehydrogenase, decarboxylating 5761
Table of Contents
Analysing search results
Handling identification data
Top
While searches are generally performed using third-party software
independently of R or can be started from R using a system call, the
rTANDEM package allows one to execute such searches
using the X!Tandem engine. The shinyTANDEM provides an
experimental interactive interface to explore the search results.
library("rTANDEM")
?rtandem
library("shinyTANDEM")
?shinyTANDEM
Similarly, the MSGFplus package enables to perform a search using the MSGF+ engine, as illustrated below.
We search the /home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML file against the fasta file from PXD000001
using MSGFplus.
We first download the fasta files:
fas <- pxget(px, "erwinia_carotovora.fasta")
## Downloading 1 file
basename(fas)
## [1] "erwinia_carotovora.fasta"
library("MSGFplus")
msgfpar <- msgfPar(database = fas,
instrument = 'HighRes',
tda = TRUE,
enzyme = 'Trypsin',
protocol = 'iTRAQ')
idres <- runMSGF(msgfpar, mzf, memory=1000)
## '/usr/bin/java' -Xmx1000M -jar '/home/biocbuild/bbs-3.7-bioc/R/library/MSGFplus/MSGFPlus/MSGFPlus.jar' -s '/home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML' -o '/home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid' -d '/home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/erwinia_carotovora.fasta' -tda 1 -inst 1 -e 1 -protocol 2
##
## reading TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid... DONE!
idres
## An mzID object
##
## Software used: MS-GF+ (version: Beta (v10072))
##
## Rawfile: /home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML
##
## Database: /home/biocbuild/bbs-3.7-workflows/meat/.buildwebvig/proteomics/erwinia_carotovora.fasta
##
## Number of scans: 5343
## Number of PSM's: 5656
## identification file (needed below)
basename(mzID::files(idres)$id)
## [1] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid"
(Note that in the runMSGF call above, I explicitly reduce the memory
allocated to the java virtual machine to 3.5GB. In general, there is
no need to specify this argument, unless you experience an error
regarding the maximum heap size).
A graphical interface to perform the search the data and explore the results is also available:
library("MSGFgui")
MSGFgui()
Table of Contents
High-level data interface
MS/MS database search
Top
The MSnID package can be used for post-search filtering
of MS/MS identifications. One starts with the construction of an
MSnID object that is populated with identification results that can
be imported from a data.frame or from mzIdenML files. Here, we
will use the example identification data provided with the package.
mzids <- system.file("extdata", "c_elegans.mzid.gz", package="MSnID")
basename(mzids)
## [1] "c_elegans.mzid.gz"
We start by loading the package, initialising the MSnID object, and
add the identification result from our mzid file (there could of
course be more that one).
library("MSnID")
msnid <- MSnID(".")
## Note, the anticipated/suggested columns in the
## peptide-to-spectrum matching results are:
## -----------------------------------------------
## accession
## calculatedMassToCharge
## chargeState
## experimentalMassToCharge
## isDecoy
## peptide
## spectrumFile
## spectrumID
msnid <- read_mzIDs(msnid, mzids)
## Reading from mzIdentMLs ...
## reading c_elegans.mzid.gz... DONE!
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 12263 at 36 % FDR
## #peptides: 9489 at 44 % FDR
## #accessions: 7414 at 76 % FDR
Printing the MSnID object returns some basic information such as
The package then enables to define, optimise and apply filtering based for example on missed cleavages, identification scores, precursor mass errors, etc. and assess PSM, peptide and protein FDR levels. To properly function, it expects to have access to the following data
## [1] "accession" "calculatedMassToCharge"
## [3] "chargeState" "experimentalMassToCharge"
## [5] "isDecoy" "peptide"
## [7] "spectrumFile" "spectrumID"
which are indeed present in our data:
names(msnid)
## [1] "spectrumID" "scan number(s)"
## [3] "acquisitionNum" "passThreshold"
## [5] "rank" "calculatedMassToCharge"
## [7] "experimentalMassToCharge" "chargeState"
## [9] "MS-GF:DeNovoScore" "MS-GF:EValue"
## [11] "MS-GF:PepQValue" "MS-GF:QValue"
## [13] "MS-GF:RawScore" "MS-GF:SpecEValue"
## [15] "AssumedDissociationMethod" "IsotopeError"
## [17] "isDecoy" "post"
## [19] "pre" "end"
## [21] "start" "accession"
## [23] "length" "description"
## [25] "pepSeq" "modified"
## [27] "modification" "idFile"
## [29] "spectrumFile" "databaseFile"
## [31] "peptide"
Here, we summarise a few steps and redirect the reader to the package’s vignette for more details:
Cleaning irregular cleavages at the termini of the peptides and
missing cleavage site within the peptide sequences. The following two
function call create the new numMisCleavages and numIrrCleabages
columns in the MSnID object
msnid <- assess_termini(msnid, validCleavagePattern="[KR]\\.[^P]")
msnid <- assess_missed_cleavages(msnid, missedCleavagePattern="[KR](?=[^P$])")
Table of Contents
Parent ion mass errors
Analysing search results
Now, we can use the apply_filter function to effectively apply
filters. The strings passed to the function represent expressions that
will be evaludated, this keeping only PSMs that have 0 irregular
cleavages and 2 or less missed cleavages.
msnid <- apply_filter(msnid, "numIrregCleavages == 0")
msnid <- apply_filter(msnid, "numMissCleavages <= 2")
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 7838 at 17 % FDR
## #peptides: 5598 at 23 % FDR
## #accessions: 3759 at 53 % FDR
Table of Contents
Filtering criteria
Trimming the data
Analysing search results
Using "calculatedMassToCharge" and "experimentalMassToCharge", the
mass_measurement_error function calculates the parent ion mass
measurement error in parts per million.
summary(mass_measurement_error(msnid))
## Min. 1st Qu. Median Mean 3rd Qu. Max.
## -2184.0640 -0.6992 0.0000 17.6146 0.7512 2012.5178
We then filter any matches that do not fit the +/- 20 ppm tolerance
msnid <- apply_filter(msnid, "abs(mass_measurement_error(msnid)) < 20")
summary(mass_measurement_error(msnid))
## Min. 1st Qu. Median Mean 3rd Qu. Max.
## -19.7797 -0.5866 0.0000 -0.2970 0.5713 19.6758
Table of Contents
Filter optimisation
Parent ion mass errors
Analysing search results
Filtering of the identification data will rely on
msnid$msmsScore <- -log10(msnid$`MS-GF:SpecEValue`)
msnid$absParentMassErrorPPM <- abs(mass_measurement_error(msnid))
MS2 fiters are handled by a special MSnIDFilter class objects, where
individual filters are set by name (that is present in names(msnid))
and comparison operator (>, <, = , …) defining if we should retain
hits with higher or lower given the threshold and finally the
threshold value itself.
filtObj <- MSnIDFilter(msnid)
filtObj$absParentMassErrorPPM <- list(comparison="<", threshold=10.0)
filtObj$msmsScore <- list(comparison=">", threshold=10.0)
show(filtObj)
## MSnIDFilter object
## (absParentMassErrorPPM < 10) & (msmsScore > 10)
We can then evaluate the filter on the identification data object, which return the false discovery rate and number of retained identifications for the filtering criteria at hand.
evaluate_filter(msnid, filtObj)
## fdr n
## PSM 0 3807
## peptide 0 2455
## accession 0 1009
Table of Contents
Filtering criteria
Analysing search results
Rather than setting filtering values by hand, as shown above, these can be set automativally to meet a specific false discovery rate.
filtObj.grid <- optimize_filter(filtObj, msnid, fdr.max=0.01,
method="Grid", level="peptide",
n.iter=500)
show(filtObj.grid)
## MSnIDFilter object
## (absParentMassErrorPPM < 3) & (msmsScore > 7.4)
evaluate_filter(msnid, filtObj.grid)
## fdr n
## PSM 0.004097561 5146
## peptide 0.006447651 3278
## accession 0.021996616 1208
Filters can eventually be applied (rather than just evaluated) using
the apply_filter function.
msnid <- apply_filter(msnid, filtObj.grid)
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 5146 at 0.41 % FDR
## #peptides: 3278 at 0.64 % FDR
## #accessions: 1208 at 2.2 % FDR
And finally, identifications that matched decoy and contaminant protein sequences are removed
msnid <- apply_filter(msnid, "isDecoy == FALSE")
msnid <- apply_filter(msnid, "!grepl('Contaminant',accession)")
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 5117 at 0 % FDR
## #peptides: 3251 at 0 % FDR
## #accessions: 1179 at 0 % FDR
The resulting filtered identification data can be exported to a
data.frame or to a dedicated MSnSet data structure for
quantitative MS data, described below, and further processed and
analyses using appropriate statistical tests.
Table of Contents
Quantitative proteomics
Analysing search results
Top
The above sections introduced low-level interfaces to raw and
identification results. The MSnbase package provides
abstractions for raw data through the MSnExp class and containers
for quantification data via the MSnSet class. Both store
spectra (or the [, [[ operators) or exprs;data.frame with pData;data.frame with fData.Another useful slot is processingData, accessed with
processingData(.), that records all the processing that objects have
undergone since their creation (see examples below).
The readMSData will parse the raw data, extract the MS2 spectra (by
default) and construct an MS experiment object of class MSnExp.
(Note that while readMSData supports MS1 data, this is currently not
convenient as all the data is read into memory.)
library("MSnbase")
rawFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
full.name = TRUE, pattern = "mzXML$")
basename(rawFile)
## [1] "dummyiTRAQ.mzXML"
msexp <- readMSData(rawFile, verbose = FALSE, centroided = FALSE)
msexp
## MSn experiment data ("MSnExp")
## Object size in memory: 0.18 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 5
## MSn retention times: 25:1 - 25:2 minutes
## - - - Processing information - - -
## Data loaded: Fri May 18 08:49:33 2018
## MSnbase version: 2.6.0
## - - - Meta data - - -
## phenoData
## rowNames: dummyiTRAQ.mzXML
## varLabels: sampleNames
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: F1.S1 F1.S2 ... F1.S5 (5 total)
## fvarLabels: spectrum
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
MS2 spectra can be extracted as a list of Spectrum2 objects with the
spectra accessor or as a subset of the original MSnExp data with
the [ operator. Individual spectra can be accessed with [[.
length(msexp)
## [1] 5
msexp[1:2]
## MSn experiment data ("MSnExp")
## Object size in memory: 0.07 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 2
## MSn retention times: 25:1 - 25:2 minutes
## - - - Processing information - - -
## Data loaded: Fri May 18 08:49:33 2018
## Data [numerically] subsetted 2 spectra: Fri May 18 08:49:33 2018
## MSnbase version: 2.6.0
## - - - Meta data - - -
## phenoData
## rowNames: dummyiTRAQ.mzXML
## varLabels: sampleNames
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: F1.S1 F1.S2
## fvarLabels: spectrum
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
msexp[[2]]
## Object of class "Spectrum2"
## Precursor: 546.9586
## Retention time: 25:2
## Charge: 3
## MSn level: 2
## Peaks count: 1012
## Total ion count: 56758067
The identification results stemming from the same raw data file can then be used to add PSM matches.
fData(msexp)
## spectrum
## F1.S1 1
## F1.S2 2
## F1.S3 3
## F1.S4 4
## F1.S5 5
## find path to a mzIdentML file
identFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
full.name = TRUE, pattern = "dummyiTRAQ.mzid")
basename(identFile)
## [1] "dummyiTRAQ.mzid"
msexp <- addIdentificationData(msexp, identFile)
fData(msexp)
## spectrum acquisition.number sequence chargeState rank
## F1.S1 1 1 VESITARHGEVLQLRPK 3 1
## F1.S2 2 2 IDGQWVTHQWLKK 3 1
## F1.S3 3 3 <NA> NA NA
## F1.S4 4 4 <NA> NA NA
## F1.S5 5 5 LVILLFR 2 1
## passThreshold experimentalMassToCharge calculatedMassToCharge modNum
## F1.S1 TRUE 645.3741 645.0375 0
## F1.S2 TRUE 546.9586 546.9633 0
## F1.S3 NA NA NA NA
## F1.S4 NA NA NA NA
## F1.S5 TRUE 437.8040 437.2997 0
## isDecoy post pre start end DatabaseAccess DBseqLength DatabaseSeq
## F1.S1 FALSE A R 170 186 ECA0984 231
## F1.S2 FALSE A K 50 62 ECA1028 275
## F1.S3 NA <NA> <NA> NA NA <NA> NA <NA>
## F1.S4 NA <NA> <NA> NA NA <NA> NA <NA>
## F1.S5 FALSE L K 22 28 ECA0510 166
## DatabaseDescription
## F1.S1 ECA0984 DNA mismatch repair protein
## F1.S2 ECA1028 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
## F1.S3 <NA>
## F1.S4 <NA>
## F1.S5 ECA0510 putative capsular polysacharide biosynthesis transferase
## idFile MS.GF.RawScore MS.GF.DeNovoScore MS.GF.SpecEValue
## F1.S1 dummyiTRAQ.mzid -39 77 5.527468e-05
## F1.S2 dummyiTRAQ.mzid -30 39 9.399048e-06
## F1.S3 <NA> NA NA NA
## F1.S4 <NA> NA NA NA
## F1.S5 dummyiTRAQ.mzid -42 5 2.577830e-04
## MS.GF.EValue modName modMass modLocation subOriginalResidue
## F1.S1 79.36958 <NA> NA NA <NA>
## F1.S2 13.46615 <NA> NA NA <NA>
## F1.S3 NA <NA> NA NA <NA>
## F1.S4 NA <NA> NA NA <NA>
## F1.S5 366.38422 <NA> NA NA <NA>
## subReplacementResidue subLocation nprot npep.prot npsm.prot npsm.pep
## F1.S1 <NA> NA 1 1 1 1
## F1.S2 <NA> NA 1 1 1 1
## F1.S3 <NA> NA NA NA NA NA
## F1.S4 <NA> NA NA NA NA NA
## F1.S5 <NA> NA 1 1 1 1
The readMSData and addIdentificationData make use of mzR and
mzID packages to access the raw and identification data.
Spectra and (parts of) experiments can be extracted and plotted.
msexp[[1]]
## Object of class "Spectrum2"
## Precursor: 645.3741
## Retention time: 25:1
## Charge: 3
## MSn level: 2
## Peaks count: 2921
## Total ion count: 668170086
plot(msexp[[1]], full=TRUE)
msexp[1:3]
## MSn experiment data ("MSnExp")
## Object size in memory: 0.11 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 3
## MSn retention times: 25:1 - 25:2 minutes
## - - - Processing information - - -
## Data loaded: Fri May 18 08:49:33 2018
## Data [numerically] subsetted 3 spectra: Fri May 18 08:49:34 2018
## MSnbase version: 2.6.0
## - - - Meta data - - -
## phenoData
## rowNames: dummyiTRAQ.mzXML
## varLabels: sampleNames
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: F1.S1 F1.S2 F1.S3
## fvarLabels: spectrum acquisition.number ... npsm.pep (33 total)
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
plot(msexp[1:3], full=TRUE)
Table of Contents
Importing third-party quantitation data
High-level data interface
Top
There are a wide range of proteomics quantitation techniques that can broadly be classified as labelled vs. label-free, depending whether the features are labelled prior the MS acquisition and the MS level at which quantitation is inferred, namely MS1 or MS2.
| Label-free | Labelled | |
|---|---|---|
| MS1 | XIC | SILAC, 15N |
| MS2 | Counting | iTRAQ, TMT |
In terms of raw data quantitation, most efforts have been devoted to MS2-level quantitation. Label-free XIC quantitation has however been addressed in the frame of metabolomics data processing by the xcms infrastructure.
An MSnExp is converted to an MSnSet by the quantitation
method. Below, we use the iTRAQ 4-plex isobaric tagging strategy
(defined by the iTRAQ4 parameter; other tags are available) and the
trapezoidation method to calculate the area under the isobaric
reporter peaks.
plot(msexp[[1]], full=TRUE, reporters = iTRAQ4)
msset <- quantify(msexp, method = "trap", reporters = iTRAQ4, verbose=FALSE)
exprs(msset)
## iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## F1.S1 4483.320 4873.996 6743.441 4601.378
## F1.S2 1918.082 1418.040 1117.601 1581.954
## F1.S3 15210.979 15296.256 15592.760 16550.502
## F1.S4 4133.103 5069.983 4724.845 4694.801
## F1.S5 11947.881 13061.875 12809.491 12911.479
processingData(msset)
## - - - Processing information - - -
## Data loaded: Fri May 18 08:49:33 2018
## iTRAQ4 quantification by trapezoidation: Fri May 18 08:49:37 2018
## MSnbase version: 2.6.0
Other MS2 quantitation methods available in quantify include the
(normalised) spectral index SI and (normalised) spectral abundance
factor SAF or simply a simple count method.
exprs(si <- quantify(msexp, method = "SIn"))
## dummyiTRAQ.mzXML
## ECA0510 0.0006553518
## ECA0984 0.0035384487
## ECA1028 0.0002684726
exprs(saf <- quantify(msexp, method = "NSAF"))
## dummyiTRAQ.mzXML
## ECA0510 0.4306167
## ECA0984 0.3094475
## ECA1028 0.2599359
Note that spectra that have not been assigned any peptide (NA) or
that match non-unique peptides (npsm > 1) are discarded in the
counting process.
See also The isobar package supports quantitation
from centroided mgf peak lists or its own tab-separated files that
can be generated from Mascot and Phenyx vendor files.
Table of Contents
Data processing and analysis
Quantitative proteomics
Top
The PSI mzTab file format is aimed at providing a simpler (than XML
formats) and more accessible file format to the wider community. It is
composed of a key-value metadata section and peptide/protein/small
molecule tabular sections.
Note that below, we specify version 0.9 (that generates the warning)
to fit with the file. For recent files, the version argument would
be ignored to use the recent importer.
mztf <- pxget(px, "F063721.dat-mztab.txt")
## Downloading 1 file
(mzt <- readMzTabData(mztf, what = "PEP", version = "0.9"))
## Warning: Version 0.9 is deprecated. Please see '?readMzTabData' and '?MzTab' for
## details.
## MSnSet (storageMode: lockedEnvironment)
## assayData: 1528 features, 6 samples
## element names: exprs
## protocolData: none
## phenoData
## sampleNames: sub[1] sub[2] ... sub[6] (6 total)
## varLabels: abundance
## varMetadata: labelDescription
## featureData
## featureNames: 1 2 ... 1528 (1528 total)
## fvarLabels: sequence accession ... uri (14 total)
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:
## - - - Processing information - - -
## mzTab read: Fri May 18 08:49:41 2018
## MSnbase version: 2.6.0
It is also possible to import arbitrary spreadsheets as MSnSet
objects into R with the readMSnSet2 function. The main 2 arguments
of the function are (1) a text-based spreadsheet and (2) column names
of indices that identify the quantitation data. The latter can be
queried with the getEcols function.
csv <- dir(system.file ("extdata" , package = "pRolocdata"),
full.names = TRUE, pattern = "pr800866n_si_004-rep1.csv")
getEcols(csv, split = ",")
## [1] "\"Protein ID\"" "\"FBgn\""
## [3] "\"Flybase Symbol\"" "\"No. peptide IDs\""
## [5] "\"Mascot score\"" "\"No. peptides quantified\""
## [7] "\"area 114\"" "\"area 115\""
## [9] "\"area 116\"" "\"area 117\""
## [11] "\"PLS-DA classification\"" "\"Peptide sequence\""
## [13] "\"Precursor ion mass\"" "\"Precursor ion charge\""
## [15] "\"pd.2013\"" "\"pd.markers\""
ecols <- 7:10
res <- readMSnSet2(csv, ecols)
head(exprs(res))
## area.114 area.115 area.116 area.117
## 1 0.379000 0.281000 0.225000 0.114000
## 2 0.420000 0.209667 0.206111 0.163889
## 3 0.187333 0.167333 0.169667 0.476000
## 4 0.247500 0.253000 0.320000 0.179000
## 5 0.216000 0.183000 0.342000 0.259000
## 6 0.072000 0.212333 0.573000 0.142667
head(fData(res))
## Protein.ID FBgn Flybase.Symbol No..peptide.IDs Mascot.score
## 1 CG10060 FBgn0001104 G-ialpha65A 3 179.86
## 2 CG10067 FBgn0000044 Act57B 5 222.40
## 3 CG10077 FBgn0035720 CG10077 5 219.65
## 4 CG10079 FBgn0003731 Egfr 2 86.39
## 5 CG10106 FBgn0029506 Tsp42Ee 1 52.10
## 6 CG10130 FBgn0010638 Sec61beta 2 79.90
## No..peptides.quantified PLS.DA.classification Peptide.sequence
## 1 1 PM
## 2 9 PM
## 3 3
## 4 2 PM
## 5 1 GGVFDTIQK
## 6 3 ER/Golgi
## Precursor.ion.mass Precursor.ion.charge pd.2013 pd.markers
## 1 PM unknown
## 2 PM unknown
## 3 unknown unknown
## 4 PM unknown
## 5 626.887 2 Phenotype 1 unknown
## 6 ER/Golgi ER
Table of Contents
Statistical analysis
Importing third-party quantitation data
Top
Processing and normalisation
For raw data processing look at MSnbase’s clean, smooth,
pickPeaks, removePeaks and trimMz for MSnExp and spectra
processing methods.
The MALDIquantand xcms packages also features a wide range of raw data processing methods on their own ad hoc data instance types.
Table of Contents
Raw data processing
Data processing and analysis
Each different types of quantitative data will require their own
pre-processing and normalisation steps. Both isobar and MSnbase
allow to correct for isobaric tag impurities normalise the
quantitative data.
data(itraqdata)
qnt <- quantify(itraqdata, method = "trap",
reporters = iTRAQ4, verbose = FALSE)
impurities <- matrix(c(0.929,0.059,0.002,0.000,
0.020,0.923,0.056,0.001,
0.000,0.030,0.924,0.045,
0.000,0.001,0.040,0.923),
nrow=4, byrow = TRUE)
## or, using makeImpuritiesMatrix()
## impurities <- makeImpuritiesMatrix(4)
qnt.crct <- purityCorrect(qnt, impurities)
processingData(qnt.crct)
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## iTRAQ4 quantification by trapezoidation: Fri May 18 08:49:43 2018
## Purity corrected: Fri May 18 08:49:43 2018
## MSnbase version: 1.1.22
Various normalisation methods can be applied the MSnSet instances
using the normalise method: variance stabilisation (vsn), quantile
(quantiles), median or mean centring (center.media or
center.mean), …
qnt.crct.nrm <- normalise(qnt.crct, "quantiles")
The combineFeatures method combines spectra/peptides quantitation
values into protein data. The grouping is defined by the groupBy
parameter, which is generally taken from the feature metadata (protein
accessions, for example).
## arbitraty grouping
g <- factor(c(rep(1, 25), rep(2, 15), rep(3, 15)))
g
## [1] 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2
## [39] 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3
## Levels: 1 2 3
prt <- combineFeatures(qnt.crct.nrm, groupBy = g, fun = "sum")
## Your data contains missing values. Please read the relevant section in
## the combineFeatures manual page for details the effects of missing
## values on data aggregation.
processingData(prt)
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## iTRAQ4 quantification by trapezoidation: Fri May 18 08:49:43 2018
## Purity corrected: Fri May 18 08:49:43 2018
## Normalised (quantiles): Fri May 18 08:49:43 2018
## Combined 55 features into 3 using sum: Fri May 18 08:49:44 2018
## MSnbase version: 2.6.0
Finally, proteomics data analysis is generally hampered by missing values. Missing data imputation is a sensitive operation whose success will be guided by many factors, such as degree and (non-)random nature of the missingness.
Below, missing values are randomly assigned to our test data and visualised on a heatmap.
set.seed(1)
qnt0 <- qnt
exprs(qnt0)[sample(prod(dim(qnt0)), 10)] <- NA
table(is.na(qnt0))
##
## FALSE TRUE
## 209 11
image(qnt0)
Missing value in MSnSet instances can be filtered out and imputed
using the filterNA and impute functions.
## remove features with missing values
qnt00 <- filterNA(qnt0)
dim(qnt00)
## [1] 44 4
any(is.na(qnt00))
## [1] FALSE
## impute missing values using knn imputation
qnt.imp <- impute(qnt0, method = "knn")
dim(qnt.imp)
## [1] 55 4
any(is.na(qnt.imp))
## [1] FALSE
There are various methods to perform data imputation, as described in
?impute.
Table of Contents
Machine learning
Data processing and analysis
Top
R in general and Bioconductor in particular are well suited for the statistical analysis of data. Several packages provide dedicated resources for proteomics data:
MSstats: A set of tools for statistical relative
protein significance analysis in DDA, SRM and DIA experiments. Data
stored in data.frame or MSnSet objects can be used as input.
msmsTests: Statistical tests for label-free LC-MS/MS
data by spectral counts, to discover differentially expressed
proteins between two biological conditions. Three tests are
available: Poisson GLM regression, quasi-likelihood GLM regression,
and the negative binomial of the edgeR
package. All can be readily applied on MSnSet instances produced,
for example by MSnID.
isobar also provides dedicated infrastructure for the statistical analysis of isobaric data.
Table of Contents
Annotation
Statistical analysis
Top
The MLInterfaces package provides a unified interface
to a wide range of machine learning algorithms. Initially developed
for microarray and ExpressionSet instances, the
pRoloc package enables application of these algorithms
to MSnSet data.
Table of Contents
Clustering
Machine learning
The example below uses knn with the 5 closest neighbours as an
illustration to classify proteins of unknown sub-cellular localisation
to one of 9 possible organelles.
library("MLInterfaces")
library("pRoloc")
library("pRolocdata")
data(dunkley2006)
traininds <- which(fData(dunkley2006)$markers != "unknown")
ans <- MLearn(markers ~ ., data = t(dunkley2006), knnI(k = 5), traininds)
ans
## MLInterfaces classification output container
## The call was:
## MLearn(formula = markers ~ ., data = t(dunkley2006), .method = knnI(k = 5),
## trainInd = traininds)
## Predicted outcome distribution for test set:
##
## ER lumen ER membrane Golgi Mitochondrion Plastid
## 5 140 67 51 29
## PM Ribosome TGN vacuole
## 89 31 6 10
## Summary of scores on test set (use testScores() method for details):
## Min. 1st Qu. Median Mean 3rd Qu. Max.
## 0.4000 1.0000 1.0000 0.9332 1.0000 1.0000
Table of Contents
Classification
Machine learning
kcl <- MLearn( ~ ., data = dunkley2006, kmeansI, centers = 12)
kcl
## clusteringOutput: partition table
##
## 1 2 3 4 5 6 7 8 9 10 11 12
## 55 28 29 18 60 30 44 145 78 116 33 53
## The call that created this object was:
## MLearn(formula = ~., data = dunkley2006, .method = kmeansI, centers = 12)
plot(kcl, exprs(dunkley2006))
A wide range of classification and clustering algorithms are also
available, as described in the ?MLearn documentation page. The
pRoloc package also uses MSnSet instances as input and ,while
being conceived with the analysis of spatial/organelle proteomics data
in mind, is applicable many use cases.
Table of Contents
Other relevant packages/pipelines
Machine learning
Top
All the Bioconductor annotation infrastructure, such as biomaRt, GO.db, organism specific annotations, .. are directly relevant to the analysis of proteomics data. A total of 208 ontologies, including some proteomics-centred annotations such as the PSI Mass Spectrometry Ontology, Molecular Interaction (PSI MI 2.5) or Protein Modifications are available through the rols
library("rols")
res <- OlsSearch(q = "ESI", ontology = "MS", exact = TRUE)
res
## Object of class 'OlsSearch':
## ontolgy: MS
## query: ESI
## requested: 20 (out of 1)
## response(s): 0
There is a single exact match (default is to retrieve 20 results),
that can be retrieved and coreced to a Terms or data.frame object
with
res <- olsSearch(res)
as(res, "Terms")
## Object of class 'Terms' with 1 entries
## From the MS ontology
## MS:1000073
as(res, "data.frame")
## id
## 1 ms:class:http://purl.obolibrary.org/obo/MS_1000073
## iri short_form obo_id
## 1 http://purl.obolibrary.org/obo/MS_1000073 MS_1000073 MS:1000073
## label
## 1 electrospray ionization
## description
## 1 A process in which ionized species in the gas phase are produced from an analyte-containing solution via highly charged fine droplets, by means of spraying the solution from a narrow-bore needle tip at atmospheric pressure in the presence of a high electric field. When a pressurized gas is used to aid in the formation of a stable spray, the term pneumatically assisted electrospray ionization is used. The term ion spray is not recommended.
## ontology_name ontology_prefix type is_defining_ontology
## 1 ms MS class TRUE
Data from the Human Protein Atlas is available via the hpar package.
Table of Contents
Annotation
Top
Additional relevant packages are described in the RforProteomics vignettes.
Table of Contents
Other relevant packages/pipelines
Top
## R version 3.5.0 (2018-04-23)
## Platform: x86_64-pc-linux-gnu (64-bit)
## Running under: Ubuntu 16.04.4 LTS
##
## Matrix products: default
## BLAS: /home/biocbuild/bbs-3.7-bioc/R/lib/libRblas.so
## LAPACK: /home/biocbuild/bbs-3.7-bioc/R/lib/libRlapack.so
##
## attached base packages:
## [1] stats4 parallel stats graphics grDevices utils datasets
## [8] methods base
##
## other attached packages:
## [1] nloptr_1.0.4 RforProteomics_1.18.0 BiocInstaller_1.30.0
## [4] knitr_1.20 proteomics_1.2.0 hpar_1.22.0
## [7] rols_2.8.0 MSGFplus_1.14.0 pRolocdata_1.18.0
## [10] pRoloc_1.20.0 MLInterfaces_1.60.0 cluster_2.0.7-1
## [13] annotate_1.58.0 XML_3.98-1.11 AnnotationDbi_1.42.1
## [16] IRanges_2.14.10 S4Vectors_0.18.2 rpx_1.16.0
## [19] MSnbase_2.6.0 ProtGenerics_1.12.0 BiocParallel_1.14.1
## [22] Biobase_2.40.0 BiocGenerics_0.26.0 MSnID_1.14.0
## [25] mzID_1.18.0 mzR_2.14.0 Rcpp_0.12.16
## [28] BiocStyle_2.8.1
##
## loaded via a namespace (and not attached):
## [1] R.utils_2.6.0 RUnit_0.4.31
## [3] tidyselect_0.2.4 RSQLite_2.1.1
## [5] htmlwidgets_1.2 grid_3.5.0
## [7] trimcluster_0.1-2 lpSolve_5.6.13
## [9] rda_1.0.2-2 munsell_0.4.3
## [11] codetools_0.2-15 preprocessCore_1.42.0
## [13] DT_0.4 withr_2.1.2
## [15] colorspace_1.3-2 Category_2.46.0
## [17] highr_0.6 geometry_0.3-6
## [19] robustbase_0.93-0 dimRed_0.1.0
## [21] labeling_0.3 mnormt_1.5-5
## [23] hwriter_1.3.2 bit64_0.9-7
## [25] ggvis_0.4.3 rprojroot_1.3-2
## [27] ipred_0.9-6 xfun_0.1
## [29] randomForest_4.6-14 diptest_0.75-7
## [31] R6_2.2.2 doParallel_1.0.11
## [33] gridSVG_1.6-0 flexmix_2.3-14
## [35] DRR_0.0.3 bitops_1.0-6
## [37] assertthat_0.2.0 promises_1.0.1
## [39] scales_0.5.0 nnet_7.3-12
## [41] gtable_0.2.0 biocViews_1.48.0
## [43] affy_1.58.0 ddalpha_1.3.3
## [45] timeDate_3043.102 rlang_0.2.0
## [47] CVST_0.2-1 genefilter_1.62.0
## [49] RcppRoll_0.2.2 splines_3.5.0
## [51] lazyeval_0.2.1 ModelMetrics_1.1.0
## [53] impute_1.54.0 hexbin_1.27.2
## [55] broom_0.4.4 yaml_2.1.19
## [57] reshape2_1.4.3 abind_1.4-5
## [59] threejs_0.3.1 crosstalk_1.0.0
## [61] backports_1.1.2 httpuv_1.4.3
## [63] RBGL_1.56.0 caret_6.0-79
## [65] tools_3.5.0 lava_1.6.1
## [67] bookdown_0.7 psych_1.8.4
## [69] ggplot2_2.2.1 affyio_1.50.0
## [71] RColorBrewer_1.1-2 proxy_0.4-22
## [73] plyr_1.8.4 base64enc_0.1-3
## [75] progress_1.1.2 zlibbioc_1.26.0
## [77] purrr_0.2.4 RCurl_1.95-4.10
## [79] prettyunits_1.0.2 rpart_4.1-13
## [81] viridis_0.5.1 sampling_2.8
## [83] sfsmisc_1.1-2 magrittr_1.5
## [85] data.table_1.11.2 pcaMethods_1.72.0
## [87] mvtnorm_1.0-7 whisker_0.3-2
## [89] R.cache_0.13.0 mime_0.5
## [91] evaluate_0.10.1 xtable_1.8-2
## [93] mclust_5.4 gridExtra_2.3
## [95] compiler_3.5.0 biomaRt_2.36.0
## [97] tibble_1.4.2 R.oo_1.22.0
## [99] htmltools_0.3.6 later_0.7.2
## [101] tidyr_0.8.0 lubridate_1.7.4
## [103] DBI_1.0.0 magic_1.5-8
## [105] MASS_7.3-50 fpc_2.1-11
## [107] Matrix_1.2-14 vsn_3.48.0
## [109] R.methodsS3_1.7.1 gdata_2.18.0
## [111] mlbench_2.1-1 bindr_0.1.1
## [113] gower_0.1.2 igraph_1.2.1
## [115] pkgconfig_2.0.1 foreign_0.8-70
## [117] recipes_0.1.2 MALDIquant_1.17
## [119] xml2_1.2.0 foreach_1.4.4
## [121] prodlim_2018.04.18 stringr_1.3.1
## [123] digest_0.6.15 pls_2.6-0
## [125] graph_1.58.0 rmarkdown_1.9
## [127] dendextend_1.8.0 GSEABase_1.42.0
## [129] curl_3.2 kernlab_0.9-26
## [131] shiny_1.1.0 gtools_3.5.0
## [133] modeltools_0.2-21 nlme_3.1-137
## [135] jsonlite_1.5 bindrcpp_0.2.2
## [137] interactiveDisplay_1.18.0 viridisLite_0.3.0
## [139] limma_3.36.1 pillar_1.2.2
## [141] lattice_0.20-35 httr_1.3.1
## [143] DEoptimR_1.0-8 survival_2.42-3
## [145] interactiveDisplayBase_1.18.0 glue_1.2.0
## [147] FNN_1.1 gbm_2.1.3
## [149] prabclus_2.2-6 iterators_1.0.9
## [151] bit_1.1-13 class_7.3-14
## [153] stringi_1.2.2 blob_1.1.1
## [155] memoise_1.1.0 dplyr_0.7.4
## [157] e1071_1.6-8